APIBIPP

Loading

  • Sep, Thu, 2020

sunifiram powder

Quick Details Port: shenzhen Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram,PayPal Supply Ability: 5000.0 Kilogram/Kilograms per Week Other Names: Sunifiram Usage: Animal Pharmaceuticals Grade Standard: Medicine Grade Product Name: Sunifiram Purity: 99%min Shelf life: 2 Years Appearance: White Powder CAS No.: 314728-85-3 Type: Antibiotic and Antimicrobial Agents EINECS No.: N/A MF: C14H18N2O2 Packaging Detail: customized   Name: Fasoracetam CAS No.: 314728-85-3 MF: C14H18N2O2 Appearance: White Fine Powder purity  > 99.0% Brand Name  RUNK Delivery time  Within 1-2 days payment Business Type  Manufacturer Factory Export Markets Global    Sunifiram is a research ampakine that is becoming very popular amongst researchers. As an ampakine, it works to improve the ability of the AMPA glutamate receptors. Sunifiram works by stimulating the AMPA receptor currents therefore improving the glutamate signal.  Hot Products       Contact me to see clear Lab Test Report   Name CAS Purity   N-Acetyl-L-cysteine ethyl ester 59587-09-6 99.00%  Magnesium Taurate 334824-43-0 99.00%   Amino Tadalafil Succinic Acid Sodium N/A 99.00%  Nicotinamide Riboside Chloride(NRC) 23111-00-4 99.00%   Beta-Nicotinamide Mononucleotide(NMN) 1094-61-7 99.00%   β-Nicotinamide Adenine Dinucleotide(NAD+) 53-84-9 99.00%   Olivetol(3,5-hydroxypentylbenzene) 500-66-3 99.00%   Nooglutyl 112193-35-8 99.00%  Compound 7P 1890208-58-8 98.00%   Noopept,GVS-111 157115-85-0 99.50%  Piracetam 7491-74-9 99.00%   Phenibut 1078-21-3 99.00%   Aniracetam   99.00%   Nefiracetam 77191-36-7 99.00%   Pramiracetam 68497-62-1 99.00%   Oxiracetam 62613-82-5 99.00%  Fasoracetam 110958-19-5 99.00%   Sunifiram 314728-85-3 99.50%   Coluracetam 135463-81-9 99.00%   N-Methyl-D-aspartic acid(NMDA) 6384-92-5 […]

  • Sep, Thu, 2020

M22 Professional Supply TEGO Pep UP Cosmetic Peptide Tetrapeptide-4

Quick Details Port: chengdu Payment Terms: L/C,T/T,Western Union,MoneyGram Supply Ability: 1000.0 Gram/Grams per Month Other Names: Tetrapeptide-4 Usage: Animal Pharmaceuticals Grade Standard: cosmetic grade Sample: polease contact us Color: White Color Product Name: Tetrapeptide-4 Purity: 95%min Storage Duration: 3 years Appearance: White Powder MOQ: 0.1g CAS No.: / Function: Anti-Aging Type: Vitamins, Amino Acids and Coenzymes Storage: Cool Dry Place Packing: Plastic Bottles EINECS No.: / MF: C14H22N4O7 Packaging Detail: Packaged in a transparent plastic bottle, and then wrapped with a bubble film to effectively prevent product ‘s damage. Product Description                                              Recombinant Human Collagen      Name:  Tetrapeptide-4 Alias : TEGO Pep UP Sequence : GEPG Molecular formula: C14H22N4O7 Molecular weight :  358.35 Purity:  95.0% Source:  synthetic MSDS and COA: available       Tetrapeptide-4 acts as an anti-aging, lifting and anti-wrinkle agent. It is a tetrapeptide which increases the collagen production of the skin and the fiber production in the extracellular matrix. This results in reduced wrinkle depth and more defined facial contours as visual effects. Tetrapeptide-4 is suitable for use in anti-aging and other formulations for skin care.     […]

  • Sep, Thu, 2020

China supply Glucosamine Sulfate powder price CAS 29031-19-4

Quick Details Port: China port Payment Terms: L/C,T/T,Western Union,MoneyGram, Assurance order Supply Ability: 10000 Kilogram/Kilograms per Month China supply Glucosamine Sulfate powder price CAS 29031-19-4 Other Names: Glucosamine Usage: Animal Pharmaceuticals,Active Pharmaceutical Ingredient Sample: Glucosamine Sulfate Avaliable Grade Standard: Medicine Grade Product Name: Glucosamine Sulfate powder Active Ingredient: Glucosamine Sulfate Purity: 99% Appearance: White or white crystalline powder MOQ: 1KG CAS No.: 29031-19-4 Type: Auxiliaries and Other Medicinal Chemicals Storage: Cool Dry Place EINECS No.: N/A MF: (C6H14NO5)2SO4 Shelf Life: 2 years Application: Pharmaceutical Raw Intermediates Certificate: ISO 9001 Packaging Detail: 1kg per Foil Bag, 10 Bags per carton. 25 kg per Drum. Or Customized Package. China supply Glucosamine Sulfate powder price CAS 29031-19-4

  • Sep, Thu, 2020

Magnesium gluconate cas 3632-91-5

Quick Details Port: Shanghai Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 1000 Tonne/Tonnes per Year Other Names: Magnesium Gluconate Usage: Animal Pharmaceuticals Type: Vitamins, Amino Acids and Coenzymes EINECS No.: 222-848-2 Grade Standard: cosmetic grade,Feed Grade,food grade,Medicine Grade Purity: 99% MF: C12H22MgO14,C12H22MgO14 Appearance: White Crystalline Powder CAS No.: 3632 -91-5 Packaging Detail: 25kg/drum, two plastic bags inside Magnesium gluconate cas 3632-91-5 Specifications CAS No.:3632-91-5 Other Names:magnesium D-gluconate hydrate MF:C12H22MgO14 EINECS No.:222-848-2 Place of Origin: Anhui, China (Mainland) Type:Nutrition Enhancers, Stabilizers Brand Name:Joye Model Number:food grade   Specification: Magnesium Gluconate  CAS No: 3632-91-5  EINECS No: 222-848-2  Molecular formula: C12H22MgO14  Molecuar weight: 414.5997 Magnesium Gluconate Chemical name:Magnesium Gluconate Molecular formula:C12H22MgeO14.2H2O dihydrate  Molecular weight:450.63 dihydrate  CAS NO.:59625-89-7 dihydrate  Standard :USP/FCC Characters:white fine powder or granule and soluble in water.  Performance and use: mainly used as nutriment and diet additive (1) play an important role for maintaining nerve impulse drive and nerve muscle sensitivity..  (2) good magnesian food hardening agent. Packing:Paperboard drum, full paper drum and brown paper bag lined with PE plastic bag. Net weight is 25KG Storage:Store in dry, ventilated and clean environments in room temperature. Transportation:non-hazardous product and transport by general chemical products.   Item Index USP   Content 98.0%-102.0% Magnesium content:5.06%-5.86%(calculated from […]

  • Sep, Thu, 2020

Factory supply 99% Purity Melatonin bulk powder

Quick Details Port: Any port in china Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram,Paypal, Trade Assure Supply Ability: 5000.0 Kilogram/Kilograms per Month Other Names: Melatonin Usage: Animal Pharmaceuticals Molecular Weight: 232.27 Grade Standard: Medicine Grade Sample: 10-20g Boiling point: 512.8°C at 760 mmHg Product Name: Melatonin Purity: 99% Shelf life: 2 Years Appearance: White Powder CAS No.: 73-31-4 Assay: 99% Type: Antibiotic and Antimicrobial Agents,Vitamins, Amino Acids and Coenzymes,Central Nervous System Agents Storage: Cool Dry Place COA: Availale EINECS No.: 203-632-7 MF: 13N2H16O2 Package: 1kg/bag 25kg/drum Packaging Detail: 1KG/Aluminum foil bag, carton outside; 25KG/Fiber drum, double plastic-bag inside; Or as your customs requirements.

  • Sep, Thu, 2020

2019 hot selling products -eria jarensis/n phenethyl dimethylamine/

Quick Details Port: shanghai,china Payment Terms: T/T,Western Union,MoneyGram Supply Ability: 1000 Kilogram/Kilograms per Month 2019 hot selling products -eria jarensis/n phenethyl dimethylami Other Names: new dmaa Usage: Animal Pharmaceuticals Sample: Availiable Grade Standard: Other Color: White Color Powder Product Name: N-phenethyl dimethylamine Purity: 99%min Shelf life: 2 Years Grade: Food Grade, Medicine Grade Appearance: White Powder MOQ: 10gram CAS No.: 1126-71-2 Type: Vitamins, Amino Acids and Coenzymes,Other CAS: 1126-71-2 EINECS No.: / MF: C10H15N Application: Health-care Products Certificate: ISO9001 Packaging Detail: 10kg/drum ,25kg/drum,or as customer demand 2019 hot selling products -eria jarensis/n phenethyl dimethylamine/new dmaa Product Description   Product Name  N-Phenethyl Dimethylamine   Specification  99%-HPLC  Appearance  White powder  MW  –  Package  Aluminum Bag or others  MF  C10H15N  Shelf Life   2 Years  Sample  Avaliable Packaging & Shipping   Company Information   PURE SYNMR INGREDIENTS was registered in 2010 in HK. The predecessor of PURE SYNMR is Shanghai FengYi Biotechnology Co., Ltd, which mainly function as the business and customer service center.   PURE SYNMR doesn't only provide customers with the best quality dietary supplement ingredients, but also research and formulate the novel raw materials that haven't been discovered yet. Besides these, PURE SYNMR offers effective technical supports and professional documentation services to the sports […]

  • Sep, Thu, 2020

Top Quality Cas No. 29908-03-0 Powder S-Adenosylmethionine/SAM-e

Quick Details Port: Shenzhen Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 30000 Kilogram/Kilograms per Month Other Names: SAM-e Usage: Animal Pharmaceuticals Molecular Weight: 398.44 Form: Powder Form Grade Standard: Medicine Grade Product Name: S-Adenosylmethionine Purity: 99% Shelf life: 2 Years Proper Storage Grade: Phamaceutical Grade Appearance: White Powder CAS No.: 29908-03-0 Assay: Purity 99% Type: Vitamins, Amino Acids and Coenzymes Storage: Cool Dried Storage Test Standard: HPLC EINECS No.: 249-946-8 MF: C15H22N6O5S Package: 1kg/bag 25kg/drum Packaging Detail: Package 1-5kg with ziplock plastic bag inside,Aluminum foil bag outside.finally with waterproof bag. 6-15kg with plastic bag inside,Aluminum foil bag outside,finally with carton box. More than 16kg with plastic bag inside,fiber drum outside according to the extract quantity.

  • Sep, Thu, 2020

Good Price Top Quality Powder Zolmitriptan 139264-17-8

Quick Details Port: Beijing, Shanghai, Shenzhen Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 50 Kilogram/Kilograms per Month Other Names: NA Grade Standard: Medicine Grade,Tech Grade Characteristic: White to off-white powder Product Name: Zolmitriptan Purity: 99%min Grade: Phamaceutical Grade Residue on ignition: ≤0.1% Shelf life: 2 Years MW: 287.36 CAS No.: 139264-17-8 Assay: ≥99.0% Type: Antimigraine COA: avaliable Production Capacity: 50kg/month Heavy Metals: 10ppm EINECS No.: NA MF: C16H21N3O2 Packaging Detail: Bulk qty: 25kg/drum, inside two level plastic bags Small qty: Aluminium bag, inside two level plastic bags Others: can do your package or split small packages according to your request Good Price/Top Quality 99.0%, API Powder Zolmitriptan CAS#139264-17-8       WHY CHOOSE US?     1. Strong backup of facotry: high R&D ability, favorable quality and competitive price 2. Stock avaliability 3. Flexible business way, like payment term and product delivery 4. Fast response 24*7 5. A good troubleshooter/very positive attitude for after service   PRODUCT DESCRIPTION   Prodcut name Zolmitriptan Synonyms (4R)-4-[[3-(2-Dimethylaminoethyl)-1H-indol-5-yl]methyl]oxazolidin-2-one MOQ 1G CAS No. 139264-17-8 Appearance White or off- white crystalline powder Molecular Formula C16H21N3O2 Molecular Weight 287.36 Assay 99% Application Pharma grade or research purpose Packing As per your request Storage Preserve in tight,light-resistant containers in a cool […]

  • Sep, Thu, 2020

Hot selling Nootropics powder / Carphedon CAS 77472-70-9

Quick Details Port: Any port in China Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 1000 Kilogram/Kilograms per Month Other Names: Phenylpiracetam Usage: Animal Pharmaceuticals Grade Standard: cosmetic grade,Medicine Grade Purity: 99% Standard: In house,USP,JP,EP,BP Dosage Form: Powder Specification: 99% Appearance: powder CAS No.: 77472-70-9 Type: Vitamins Test Method: HPLC/UV EINECS No.: 77472-70-9 MF: C12H14N2O2, C12H14N2O2 Packaging Detail: 0.5kgs/Al-foil bag or according to your requirement    High Purity Nootropics 98% Phenylpiracetam Powder  Specification Product name:PhenylpiracetamOther Name:4-phenyl-2-pyrrolidone-1-acetamideSynonyms:2-(2-Oxo-4-phenylpyrrolidin-1-yl)acetamideCAS Number:77472-70-9MF:C12H14N2O2MW:218.25 Phenylpiracetam is a nootropic drug derived from piracetam, and is more potent (i.e. lower dosage is used). It belongs to the racetam family of nootropics. Phenylpiracetam was developed based on Piracetam, and is 8-30 times stronger than Piracetam     ITEMS SPECIFICATION RESULTS BP2010 /EP6 Appearance crystalline powder Conforms Melting point About 205°C 206.4°C~206.7°C Identification Meet the requirements Conforms Appearance of solution Clear, not more intense than Y7 Conforms PH 2.4~3.0 2.60 Loss on drying ≤0.5% 0.04% Sulphated ash ≤0.1% 0.01% Heavy metals ≤20 ppm <20 ppm Related substances ≤0.25% Conforms Assay 99.0%~101.0% 99.8% USP32 Identification Meet the requirements Conforms Loss on drying ≤0.5% 0.04% Residue on ignition ≤0.1% 0.01% Heavy metals ≤0.003% <0.003% Residue solvent – Ethanol ≤0.5% <0.04% Chloride 16.9%~17.6% 17.1% Assay 98.0%~102.0% 100.0% Conclusion: The product […]

  • Sep, Thu, 2020

Veterinary raw Cephradine l-arginine 99% powder for animal use Cas 38821-53-3

Quick Details Port: Main Chinese Port Payment Terms: L/C,T/T,Western Union,MoneyGram,credit card Supply Ability: 5000.0 Kilogram/Kilograms per Month High Quality 99% Pharm Cephradine l-arginine with lowest price Other Names: Cephradine l-arginine Usage: Animal Pharmaceuticals Grade Standard: Pharma Grade,Medicine Grade Color: white crystalline powder Purity: 99%,98%min Shelf life: 2 Years MOQ: 1 KG Certification: ISO9001 CAS No.: 38821-53-3 Type: Antineoplastic Agents,Urinary System Agents Product name: High Quality 99% Pharm Cephradine l-arginine with lowest price EINECS No.: 254-137-8 MF: C16H19N3O4S Application: Health-care Products Packaging Detail: Cefotaxime Sodium Paper Drum with 2 plastic bags or Aluminium Foiled bag with zip-lock bag.

  • Sep, Thu, 2020

Monobenzone Powder For Monobenzone Cream/4-Benzyloxyphenol

Quick Details Port: Tianjin/Shanghai/Ningbo/Dalian Payment Terms: L/C,T/T,Western Union,Paypal Supply Ability: 1000 Kilogram/Kilograms per Week Grade Standard: cosmetic grade Purity: 99% MW: 308.37 main function: Skin Whitening sample: 10g free for test MOQ: 1KG CAS No.: 103-16-2 Type: Skin Whitening appearance: White crystal powder shelf life: 24 months EINECS No.: 203-083-3 MF: C20H20O3 mesh: 100% pass 80 mesh Delivery Detail: within 3 working days after payment,according to quantity Packaging Detail: 1kg with double plastic container inside/Aluminum foil bag outside 25 kg with double plastic container inside/fiber drum outside N.W: 25kgs. I.D. 35 x H51 cm Monobenzone Powder For Monobenzone Cream/4-Benzyloxyphenol   Welcome to Realin Basic Information Product Name: Monobenzone  Appearance : Off-Wthite Powder  CAS: 103-16-2  Molecular formula: C20H20O3  Molecular weight : 308.371  Supplier name:           Xi'an Realin Synonyms: (Benzyloxy)phenol; p-Hydroxyphenyl benzyl ether; 4-(Phenylmethoxy)phenol; Agerite alba; Benoquin; Benzoquin; Benzyl hydroquinone; Depigman; Hydroquinone benzyl ether; Monobenzone; Monobenzyl hydroquinone; PBP; Pigmex; 4-benzyloxy phenol (Monobenzone); 4-benzyloxy phenol; 4-(benzyloxy)phenol; 4-Benzyloxyphenol; PHENOL,4-(PHENYLMETHOXY)-  Specification 99.5% Main Function 1.Monobenzone is the monobenzyl ether of hydroquinone. Monobenzone occurs as a white, almost tasteless crystalline powder, soluble in alcohol and practically insoluble in water.  2.Monobenzone is a compound used as a topical drug for medical depigmentation. The topical application of monobenzone in animals decreases the excretion of melanin from melanocytes.The same action is thought to be responsible for the depigmenting effect of the drug in humans. Monobenzone may cause destruction of melanocytes thus, bringing about permanent dipigmentation in vitiligo patients. 3.Monobenzone is the monobenzyl ether of hydroquinone. Monobenzone powder can be compounded to make a depigmenting cream.  It is used to whiten patchy skin and create and even skin tone that is pale and smooth. 4.Monobenzone USP, is a strong depigmentation agent, used to treat the patients suffering from vitiligo. **********************************************************************************************  Entity Shooting/Picture Show   Why Realin 1.100% Pure Nature Raw Material, Selecting excellent planting base 2.Our factory self-produced, the quality can be strictly controlled 3.Quick delivery, firm package,stocks supply 4.Professional sales team, Providing any feedback from the customers 5.Regarding customer benefit as the starting point, pay attention to the real needs of the customer Delivery/Payment Terms and Package 1.Delivery:   By UPS/DHL/TNT/EMS or by Air/ Sea as per Qty.2.Samples:   Within 48 Hours.                                                Payment: Paypal,Western Union and T/T Method: Using Western Union and Paypal when the amount is less than US$5000.   Package  1) 25kg/drum (25kg net weight, 28kg gross weight; Packed in a cardboard-drum with two  […]

  • Sep, Thu, 2020

Bulk HRK CAS 80214-83-1 Roxithromycin Powder

Quick Details Port: China port Payment Terms: L/C,T/T,Western Union,MoneyGram, Trade Assurance Supply Ability: 8000.0 Kilogram/Kilograms per Month Bulk HRK CAS 80214-83-1 Roxithromycin Powder Other Names: Roxithromycin Usage: Animal Pharmaceuticals Grade Standard: Feed Grade,food grade,Medicine Grade Sample: Roxithromycin Avaliable Product Name: Bulk HRK CAS 80214-83-1 Roxithromycin Powder Purity: 99%min Roxithromycin Active Ingredient: Roxithromycin Appearance: White Powder CAS No.: 80214-83-1 Assay: 99%min, 98.0% –101.0% Type: Antibiotic and Antimicrobial Agents Storage: Cool Dry Place CAS: 80214-83-1 EINECS No.: N/M MF: C41H76N2O15 Shelf Life: 2 years Application: Pharmaceutical Products Certificate: ISO 9001 GMP Packaging Detail: 1kg per Foil Bag, 10 Bags per carton. 25 kg per Drum. Or Customized Package Bulk HRK CAS 80214-83-1 Roxithromycin Powder

  • Sep, Thu, 2020

buy 98% powder CAS 5336-90-3 9-ACRIDINECARBOXYLIC ACID

Quick Details Port: shanghai wuhan shenzhen tianjin guangdong Payment Terms: D/A,D/P,T/T,Western Union,MoneyGram,credit card Supply Ability: 1000 Kilogram/Kilograms per Month Other Names: 9-ACRIDINECARBOXYLIC ACID Usage: Animal Pharmaceuticals Type: Antineoplastic Agents,Antiparasitic Agents,Blood System Agents,Central Nervous System Agents Keyword: 9-ACRIDINECARBOXYLIC ACID EINECS No.: 223.23 Grade Standard: cosmetic grade,Medicine Grade,Tech Grade Purity: 98%min MF: C14H9NO2 CAS No.: 5336-90-3 Packaging Detail: 10g 100g 1KG 25KG

  • Sep, Thu, 2020

Hot sale Tauroursodexycholic acid good price TUDCA powder

Quick Details Port: Wuhan/Shanghai/Other ports Payment Terms: L/C,T/T,Western Union,MoneyGram Supply Ability: 5000.0 Kilogram/Kilograms per Month Other Names: Tauroursodeoxycholic Acid Molecular Weight: 499.7 Grade Standard: Medicine Grade Product Name: Tauroursodeoxycholic Acid Purity: 98% Shelf life: 2 Years EINECS: 1308068-626-2 Appearance: White Powder Density: 1.216±0.06 g/cm3(Predicted) CAS No.: 14605-22-2 Assay: 98%min Type: Central Nervous System Agents CAS: 14605-22-2 EINECS No.: 1308068-626-2 MF: C26H45NO6S Molecular Formula: C26H45NO6S Melting point: 173-175°C Packaging Detail: 0.01Kg~5Kg/bag 25Kg/drum

  • Sep, Thu, 2020

VEGA High quality chlortetracycline HCl powder

Quick Details Port: any port of China Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 10000.0 Kilogram/Kilograms per Month Other Names: CTC HCl Type: Antibiotic and Antimicrobial Agents CAS: 64-72-2 Grade Standard: cosmetic grade,Feed Grade,food grade,Medicine Grade,Tech Grade Product Name: chlortetracycline HCl Purity: 98% MF: C22H24Cl2N2 CAS No.: 64-72-2 Packaging Detail: 25kg/drum   Quality assurance   Quick product choose,  CLICK  below keywords to view all of our products. Vitamins & Nutritions > APIs > Food Additives > Probiotic Preparation > Rumen-Protected Serious > Amino Acids > Minerals > Other >   Product Description     High quality Chlortetracycline HCl      1.Name:Chlortetracycline HCL ,CTC Hcl 2.Cas No:64-72-2 3.MF:C22H24Cl2N2 4.Use:antibiotics 5.Appearance:yellowish powder     Chlortetracycline is a tetracycline antibiotic, the first tetracycline to be identified. In veterinary medicine,    chlortetracycline is commonly used to treat conjunctivitis in cats.   Product name API grade pharmaceutical antiprotozoal drugs chlortetracycline hcl Molecular weight 515.35 CAS NO 64-72-2 Appearance Yellow crystalline powder Classification Antibiotic Agents Antibacterial Agents Antiprotozoal Agents Application  1. Chlortetracycline Hydrochloride is a tetracycline with broad-spectrum antibacterial and antiprotozoal activity.  2. Chlortetracycline hydrochloride is bacteriostatic and inhibits bacterial protein synthesis by binding to the 30S ribosomal subunit, thereby preventing the addition of amino acids to the growing peptide chain. 3. This tetracycline is active against a wide […]

  • Sep, Thu, 2020

Supply 100% Natural pharmaceutical diphenhydramine hydrochloride

Quick Details Port: Beijing, Tianjin, Shanghai,Qingdao Payment Terms: L/C,D/P,T/T,Western Union Supply Ability: 1000 Kilogram/Kilograms per Week pharmaceutical diphenhydramine hydrochloride Other Names: Diphenhydramine powder Usage: Animal Pharmaceuticals Grade Standard: Medicine Grade Product Name: pharmaceutical diphenhydramine hydrochloride Purity: 99% min Purity: 99% min Application: Antibacterial Drugs sample: free Appearance: white powder MOQ: 1KG CAS No.: 58-73-1 Type: Anti-Allergic Agents,Vitamins, Amino Acids and Coenzymes EINECS No.: 232-678-0 MF: C6H8O6 Shelf Life: 2 Years Test Method: HPLC UV Certificate: ISO, Halal, Kosher;SGS Packaging Detail: 10g/bag,100g/bag,1kg/bag. Packed with Zip lock Bag inside and Aluminium Foiled Bag outside.  Supply 100% Natural pharmaceutical diphenhydramine hydrochloride Product Description       Product Description of pharmaceutical diphenhydramine hydrochloride:                                                                                                                             Product Name diphenhydramine  powder CAS No 58-73-1 ENIECS No 232-678-0 Appearance white powder Molecular Formula C6H8O6 Molecular Weight 291.82 Assay 99.0%-101.0% Storage Keep in a cool, dry, dark location Shelf Life 24 […]

  • Sep, Thu, 2020

Leonurine Hydrochloride 24697-74-3

Quick Details Other Names: Leonurine Hydrochloride 24697-74-3 Type: Powder Grade Standard: Medicine Grade Purity: 0.999 MF: Leonurine Hydrochloride 24697-74-3 CAS No.: 24697-74-3 Selling Units: Single item Single package size: 38X38X50 cm Single gross weight: 28.0 KG Product Description                                                        About US   Health Biochemical Group now is a large incorporated industry manufacturers and suppliers of advanced refined raw materials .we focus on manufacture Pharm & chemicals functional food ingredients, nutritional Ingredients, health care products, cosmetics, pharmaceutical  and feed refined oil ,natural plant ingredients industries to provide top quality of Nation standards products.Our manufacture basement & R&D center located in Shaanxi National Aerospace Economic & Technical Development Zone . Keep serve the manufacture and the market as the R&D central task, focus on the technical research. We have 3 technology R & D platforms including biological extract, microorganism fermentation and chemical synthesis, and can independently research and develop kinds of difficult API sand pharmaceutical intermediates. Our products are exported to North and South America ,Europe , Middle East ,Africa , and other five continents and […]

  • Sep, Thu, 2020

High purity Pimobendan CAS 74150-27-9 professional engineers competitive price

Quick Details Port: Any port of China Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram,TT 100% in advance Supply Ability: 10.0 Kilogram/Kilograms per Month Other Names: Pimobendan Usage: Animal Pharmaceuticals Delivery time: Within 2days Grade Standard: food grade,Medicine Grade Product Name: Pimobendan Purity: 99% Shelf life: 2 Years Appearance: white powder Molecular weight: 334.37 CAS No.: 74150-27-9 Type: Vitamins, Amino Acids and Coenzymes,Pimobendan Payment: TT.Western Union .Credit Card Storage: Cool Dry Place Test Method: HPLC UV COA: Availalbe EINECS No.: 640-420-7 MF: C19H18N4O2 Certificate: ISO FDA COA MSDS Packaging Detail: 25kgs packaging Fiber drum outside and plastic bag inside 1-25kgs packaging aluminium bag outside and double plastic bag inside Delivery Detail: within 2 days when get the payment Shipping : We have Professional shipping agent, based on customers ‘ demand for transport By express :FEDEX,DHL,EMS ,UPS,TNT ect. By SEA and By AIR Product Description High purity Pimobendan CAS 74150-27-9 professional engineers competitive price  Introduction Product Name   Pimobendan  CAS  74150-27-9  Category  API Quality Standard EP/USP MSDS Available COA Contact with Senwayer for updated version COA. Sample Available MOQ 1g,1kg Delivery Date In 3 days Place Of Origin China Application Pharmaceutical raw materials   Function   Strong heart medicine.There are strong positive muscle strength and strong […]

  • Sep, Thu, 2020

Custom peptide FOXO4 DRI/foxo4 dri/FOXO4-DRI Peptide Chengdu Youngshe

Quick Details Port: Chengdu Payment Terms: T/T,MoneyGram Supply Ability: 500.0 Gram/Grams per Month Other Names: FOXO4-DRI Usage: Animal Pharmaceuticals Type: Vitamins, Amino Acids and Coenzymes Grade Standard: Tech Grade Purity: 95% MF: N/A CAS No.: N/A Packaging Detail: plastic/glass bottle protected by bubble film Product Description FOX 04DRI / Senolytics   FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.     FOXO4 DRI peptide comprising the amino acid sequence:LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice. New Information P1 Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.   YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.   Since […]

  • Sep, Thu, 2020

Top quality Gentamycin Sulphate 1405-41-0 with reasonable price and fast delivery on hot selling !!

Quick Details Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Other Names: Gentamycin Sulphate,Gentamycin Sulphate Usage: Animal Pharmaceuticals,Animal Pharmaceuticals CAS No: 1405-41-0 Grade Standard: Medicine Grade Purity: 99%min,99%min CAS No.: 1405-41-0 Type: Antibiotic and Antimicrobial Agents,Auxiliaries and Other Medicinal Chemicals EINECS No: 215-778-9 EINECS No.: 215-778-9 Gade Standard: Medicine Grade MF: C19H41N5O11S,C19H41N5O11S Packaging Detail: 25kgs/bag Product Description     Gentamycin Sulphate 1405-41-0   1.Competitive price2.Fast Delivery Within 2 days3.SGS , BV, GMP,ISO approve4.Professional factory Product Description   Specifications of Gentamycin Sulphate Item Specifications Results Characters White or almost white powder,freely soluble in water,practically insoluble in alcohol and in ether Complies Identification Tests according to monograph Complies Appearance of solution Clear and not more intensely colored than degree 6 of the range of reference solutions of the most appropriate color Complies PH 3.5 to 5.5 4.4 Specific optical rotation +107°to +121° +117° Methanol Not more than 1.0 percent Complies Composition C1:25.0 to 55.0 percent 27.5% C1a:10.0 to 35.0 percent 30.1% C2a +C2:25.0 to 55.0 percent 42.4% Water Not more than 15.0 percent 8.6% Sulphated ash Not more than 1.0 percent 0.4% Sulphate 32.0 to 35.0 percent 33.4% Sterility Complies with the test for sterility Complies Bacterial endotoxins Less than 1.67 IU/mg <0.71 IU/mg Assay Not […]