APIBIPP

Loading

Tag Health & Medical

  • Sep, Thu, 2020
Plant Extract

FocusHerb Soybean Extract 90% Isolated Soy Protein

Quick Details Payment Terms: L/C,T/T,Western Union,Paypal for Soy Protein Supply Ability: 5000 Kilogram/Kilograms per Month Spot Supply Soy Protein Isolated Soy Protein: 90% Form: Powder Size: 100% Pass 80 Mesh Solubility: Soluble in water Product Name: Soy Protein Extraction Type: Solvent Extraction Latin Name: Glycine Max(L.)Merr Shelf life: 2 years Grade: Pharmaceutical Grade Appearance: Light yellow to yellow fine powder Type: Soy Protein Test Method: HPLC Part: Soybean Seed Packaging: BOTTLE,DRUM,Vacuum Packed,Carton Active ingredient: Soy Protein Powder Certificate: ISO9001/Halal/Kosher/ORGAINC

  • Sep, Thu, 2020
Plant Extract

High quality black ant extract powder,black ant sex pills

Quick Details Port: Xi’an,Tianjin,Beijing,Guangzhou Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 3000 Kilogram/Kilograms per Month Sieve analysis: 100% pass 80 mesh Form: Powder Product Name: High quality black ant extract powder,black ant sex pills Extraction Type: Solvent Extraction Shelf life: 2 Years Specification: 10:1 20:1 Grade: Pharmaceutical Grade Appearance: Brown Yellow Powder Part Used: Body Type: black ant extract Part: Whole Body Packaging: DRUM,Vacuum Packed Delivery Detail: Shipped in 3 days after payment Packaging Detail: High quality black ant extract powder,black ant sex pills: 1) 25kg/drum (25kg net weight, 28kg gross weight; Packed in a cardboard-drum with two plastic-bags inside; Drum Size: 510mm high, 350mm diameter) 2) 1kg/bag (1kg net weight, 1.2kg gross weight, packed in an aluminum foil bag; Outer: paper carton; Inner: double-layer PE) High quality black ant extract powder,black ant sex pills      1) Active Ingredient:    High quality black ant extract powder,black ant sex pills 2) Specification:     10:1,20:1, 50:1 TLC 3) Appearance :    brown fine powder 4) Test :  TLC 5) Partical size: 100% pass 80 mesh 6) Function: Enhance male sexual function 7) Application: Health-care product Black ant is the unique ant proposed by the health ministry for food and medicine.it contains more than 70  […]

  • Sep, Thu, 2020
Plant Extract

China factory acai berry pulp frozen dried powder for cosmetics skin care

Quick Details Port: Guangzhou Payment Terms: L/C,T/T,Western Union,MoneyGram,pay pal Supply Ability: 100 Ton/Tons per Month Sample orders are available Form: Powder Sample: Free sample is accepted Color: Purple Extraction Type: Liquid-Solid Extraction Active Ingredient: Natural Vitamin C Shelf life: Two Years Grade: Pharmaceutical Grade Appearance: Powder Botanic Name: Euterpe badiocarpa Part Used: Berry Type: Herbal Extract,acai pulp frozen Storage: Dry Area Test Method: HPLC or UV-VIS Part: Berry Packaging: DRUM,Vacuum Packed,catton bottle Variety: Acai Berry Extract Packaging Detail: acai pulp frozen samples in aluminum foil, more than 10kg in cotton. China factory acai berry pulp frozen dried powder for cosmetics skin care   Product Description   Type acai pulp frozen Application Pharmaceutical / Dietary supplement/ Beverage / Cosmetic Specification With the function of antioxidant,anti-radicalization and anti-aging Active Ingredient Natural Vitamin C Proportion extraction 10:1 Botanic Name Euterpe badiocarpa Storage Dry Area Part Used Berry Color Purple Sample Free sample is accepted     [Functions] 1. With the function of antioxidant,anti-radicalization and anti-aging; 2. With the function of treating acute conjunctivitis, bronchitis, gastritis, enteritis and urinary stones; 3. With the function of reducing blood sugar and cholesterol and having the great effect to prevent hypertension; 4. With the function of improving blood circulation […]

  • Sep, Thu, 2020
Plant Extract

Factory supply Indonesia tongkat ali root extract 100:1 200:1 1%~12%Eurycomanone

Quick Details Port: Tianjin, Guangzhou Payment Terms: L/C,T/T,Western Union Supply Ability: 2000.0 Kilogram/Kilograms per Month Form: powder NW/GW: 25kg/28kg Extraction Type: Solvent Extraction Product Name: Tongkat ali root extract Grade: Food Specification: 1%~12% Appearance: Brown Yellow powder Particle Size: 100% Pass 80 Mesh Type: Tongkat ali root extract Storage: Far from away humidity,sunshine,high-temp Test Method: HPLC Part: root Packaging: 25kg/drum,DRUM Expiry Date: 2 years Packaging Detail: 25kg/drum (double plastic-bag inside), or according to the customers’ request. Tongkat ali root extract     Product Description   Product Name: Tongkat ali extract Appearance: brown Powder Part Used: root Specification: 1%~15%Eurycomanone Test Method: HPLC Particle Size: 100%Through 80 mesh Odor & Taste: Characteristic Packaging Detail: 25kg/drum (double plastic-bag inside, or as per customer’s request.) NW/GW:25kg/28kg Expiry Date: 2 years Storage: Far from away humidity,sunshine,high-temp and acidic, alkaline substance.   Brief description: Tongkat Ali is a popular folk name for Eurycoma longifolia, a medium size slender tree reaching 10 metres in height. The name Tongkat Ali means Alis walking stick. Another folk name for the plant is Longjack. It is native to Malaysia, lower Burma, Thailand, and Indonesia. The root is employed as a traditional remedy for the treatment of malaria, high blood pressure, fevers, fatigue, loss of sexual desire, and impotence.      Application: (1). The highest can reach 440%, promote the growth of human muscle; (2). long jack root extract has multiple effects, […]

  • Sep, Thu, 2020
Plant Extract

alpha-Arbutin 200g/pack 98% cas 84380-01-8

Quick Details Form: Powder Product Name: alpha-Arbutin Extraction Type: Solvent Extraction Purity: 98% MW: 272.25 Grade: Pharmaceutical, cosmetic, food Appearance: White Powder Type: Herbal Extract Test Method: HPLC UV CAS: 84380-01-8 Part: Bark Packaging: BOTTLE,DRUM,Vacuum Packed MF: C12H16O7 Shelf Life: 2 Years Package: 200g Packaging Detail: 1. 1-5kg/aluminium foil bag, two plastic bags inside and one aluminium foil bag outside. 2. 25kg/fiber drum, Gross Weight 28kgs. Selling Units: Single item Single package size: 20X20X20 cm Single gross weight: 0.6 KG Product Name: Alpha Arbutin Powder Appearance:White Cryatal PowderAssay:98%CAS No.:84380-01-8Solubility:Dissolved in water Function: Skin Whitening     Alpha arbutin is a whitening rookie after beta-arbutin, which source is narrow, only by different microbial enzymes for glycosylation, a molecule of hydroquinone (hydroquinone) and a The molecules of glucose combine to form a single α-arbutin.   1.Alpha arbutin powder can protect the skin against damage caused by free radicals.2.Alpha arbutin powder is a skin whitening agent which is very popular in Japan and Asian countries for skin de-pigmentation.3.Alpha arbutin powder inhibits the formation of melanin pigment by inhibiting Tyrosinase activity. 4.Alpha arbutin powder is very safe skin agent for external use which does not have toxicity, stimulation, unpleasant odor or side effect such as Hydroqinone.5.Alpha […]

  • Sep, Thu, 2020
Pharmaceutical

Anti-AIDS Lamivudine powder 134678-17-4 Lamivudine 99%

Quick Details Port: Any port in China Payment Terms: L/C,T/T,Western Union,MoneyGram,paypal Supply Ability: 2500 Kilogram/Kilograms per Month Other Names: Zidovudine CAS No: 3056-17-5 Usage: Animal Pharmaceuticals Grade Standard: Medicine Grade Color: White Product Name: Zidovudine Purity: 99%min Shelf life: 2 Years Specification: 99% Appearance: White crystals or Crystalline powder CAS No.: 3056-17-5 Type: Anti-Allergic Agents Storage: Dry Place Test Method: HPLC UV EINECS No.: 240-333-9 MF: C26H37N5O2 Service attitude: ^_^ Certificate: ISO9001 Packaging Detail: 1.0kgs/Al-foil bag, 5.0 kgs/Al-foil bag, 25.0 kgs/drum or upon customers’ request Product Description Introduction Anti-AIDS API Stavudine,zidovudine,Lamivudine,Nevirapine Product name: zidovudine CAS No.:3056-17-5 Purity: 99% min Appearance:White crystals or crystalline  Powder Related Products Specification   Company Profile Xi'an GEEKEE Bio-Tech Co.,Ltd founded in 2010, is the production enterprise which professionally works on phytoextraction, chemical synthesis pharmaceutical material and medical intermediates. The company covers an area of 30.000 square meters, and has 150 employees. The company owns advanced complete craft equipments and top quality inspection methods, Passed the GMP certification,and has set up good technical cooperation relationship with many state scientific institutes. The company considers quality as life since founded. Good credit can win trust from customers at home and abroad. The company has got good reputation. Current […]

  • Sep, Thu, 2020
Pharmaceutical

Top Quality Cas No. 29908-03-0 Powder S-Adenosylmethionine/SAM-e

Quick Details Port: Shenzhen Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 30000 Kilogram/Kilograms per Month Other Names: SAM-e Usage: Animal Pharmaceuticals Molecular Weight: 398.44 Form: Powder Form Grade Standard: Medicine Grade Product Name: S-Adenosylmethionine Purity: 99% Shelf life: 2 Years Proper Storage Grade: Phamaceutical Grade Appearance: White Powder CAS No.: 29908-03-0 Assay: Purity 99% Type: Vitamins, Amino Acids and Coenzymes Storage: Cool Dried Storage Test Standard: HPLC EINECS No.: 249-946-8 MF: C15H22N6O5S Package: 1kg/bag 25kg/drum Packaging Detail: Package 1-5kg with ziplock plastic bag inside,Aluminum foil bag outside.finally with waterproof bag. 6-15kg with plastic bag inside,Aluminum foil bag outside,finally with carton box. More than 16kg with plastic bag inside,fiber drum outside according to the extract quantity.

  • Sep, Thu, 2020
Pharmaceutical

Hot sale Tauroursodexycholic acid good price TUDCA powder

Quick Details Port: Wuhan/Shanghai/Other ports Payment Terms: L/C,T/T,Western Union,MoneyGram Supply Ability: 5000.0 Kilogram/Kilograms per Month Other Names: Tauroursodeoxycholic Acid Molecular Weight: 499.7 Grade Standard: Medicine Grade Product Name: Tauroursodeoxycholic Acid Purity: 98% Shelf life: 2 Years EINECS: 1308068-626-2 Appearance: White Powder Density: 1.216±0.06 g/cm3(Predicted) CAS No.: 14605-22-2 Assay: 98%min Type: Central Nervous System Agents CAS: 14605-22-2 EINECS No.: 1308068-626-2 MF: C26H45NO6S Molecular Formula: C26H45NO6S Melting point: 173-175°C Packaging Detail: 0.01Kg~5Kg/bag 25Kg/drum

  • Sep, Thu, 2020
Plant Extract

Best Price Valerian Root Extract Powder 10:1

Quick Details Port: Any port of mainland China Payment Terms: D/P,T/T,Western Union,paypal Supply Ability: 100000 Kilogram/Kilograms per Year valerian root extract Form: Powder Cas. No.: 8057-49-6 Product Name: valerian root extract Extraction Type: Solvent Extraction Active Ingredient: Valeric acid Latin Name: Valeriana officinalis L. Shelf life: 2 years Specification: 0.4%-8% Grade: Pharmaceutical Grade Appearance: brown Type: valerian root extract Test Method: HPLC Part: Bark Packaging: CAN,DRUM,Plastic Container Free sample: 10-20g Molecular Formula: C17H24O11 Packaging Detail: valerian root extract packed in : 1kg/2 layers food grade plastic bag, outside with Aluminum Foil Bag; 25kgs/drum, inside with 2 layers food grade plastic bag. Product Information Best Price Valerian Root Extract Powder 10:1 Specification of Valerian root extract [Product Name]: Valerian root extract [Latin Name]: Valeriana officinalis L. [Apperance]: Brown fine powder [Specification]:                         Valeric Acid: 0.4%-0.8% HPLC / UV                       Ratio:10:1 TLC [Test Method]: HPLC, UV, TLC   Function of Valerian root extract 1. With the function of antidepressant; 2. With the function of improving microcirculation;       3. With the function of antibacterial, antiviral and anti-tumor;       4. With the function of easing […]

  • Sep, Thu, 2020
Plant Extract

Pure Natural Kava Extract Kavalactone Powder 30%

Quick Details Form: Powder Extraction Type: Solvent Extraction Active Ingredient: Kavalactone Grade: TOP Grade Specification: 30% Shelf life: 24 Months Appearance: fine powder MOQ: 1 Kg Type: Herbal Extract Part Used: root Storage: Dry Place Test Method: HPLC Part: root Packaging: DRUM,Plastic Container,Vacuum Packed Package: 25kg/Paper Drum Variety: Kava Extract,Kava Extract Application: Pharmaceutical Raw Materials Packaging Detail: If small quantity, we packaged it by food-grade plastic bags. If big quantity, we use paper-drum to package it. Selling Units: Single item Single package size: 10X12X11 cm Single gross weight: 1.2 KG Product Description     Basic Information English name Kava Extract,Kavalactones Active ingredients Kavalactones Specification 30%, 70%, 10:1 Appearance Brownish Yellow Powder Test Method HPLC Brief Review of kavalactones 1.kavalactones , also known as Piper methysticum, is a tall shrub in the pepper family that grows in the South Pacific islands. It has been used there for thousands of years as a folk remedy and as a social and ceremonial beverage.The part of the plant used medicinally is the root. Although the root was traditionally chewed or made into a beverage, kava is now available in capsule, tablet, beverage, tea, and liquid extract forms.   2.The main active components in kavalactones […]

  • Sep, Thu, 2020
Plant Extract

Best Price Sida Cordifolia Extract Powder 5:1,10:1

Quick Details Port: Any port in China Payment Terms: L/C,T/T,Western Union,PayPal Supply Ability: 50 Ton/Tons per Year Form: Powder Product Name: Sida Cordifolia Extract Extraction Type: Solvent Extraction Latin Name: Sida cordifolia L. Specification: 5:1,10:1 Grade: Pharmaceuticals Ingredients,Pharmaceuticals Ingredients Appearance: brown yellow powder Part Used: Root and Stem Type: Sida Cordifolia Extract Test Method: TLC/UV Part: Root and Stem Packaging: DRUM Active ingredient: Alkaloids Odor: Characteristic Mesh size: 80 Mesh Packaging Detail: 25kg/drum or upon customers’ request   Product Name:Sida Cordifolia Extract latin Name:Sida cordifolia L.Used Part:Root and StemAppearance:brown yellow powderActive ingredient: Alkaloidsspecification: 5:1,10:1Test Method: TLC/UVMesh size: 80 MeshOdor:Characteristicshelf life:2 yearsGrade: Pharmaceuticals Ingredients What is Sida Cordifolia?Sida Cordifolia is an extract of the Sida cordifolia plant containing 0.8% to 1.2% of the alkaloid It is considered to be one of the most valuable drugs in Ayurveda. It is used by Ayurveda physicians as an antipyretic in febrile and infectious diseases, and also as an aphrodisiac. Sida Cordifolia is also useful in the treatment of chronic broncho-pulminary conditions characterized by bronchospasm and cough.       Items Specification Results Appearance Brown Yellow powder Complies Odor Characteristic Complies Assay 10:1 10:1 Sieve analysis 100% pass 80 mesh Complies Loss on Drying ≤5.0% 3.12% […]

  • Sep, Thu, 2020
Pharmaceutical

Factory directly sales Mycophenolic Acid Powder/mycophenolate mofetil

Quick Details Port: Guanzghou/Shenzhen Payment Terms: T/T,Western Union,MoneyGram,Paypal Supply Ability: 100 Kilometer/Kilometers per Year Mycophenolate mofetil Other Names: Mycophenolate mofetil Usage: Animal Pharmaceuticals Grade Standard: Medicine Grade Purity: 99.32% Mycophenolate mofetil MW: 433.49 g/mol Mycophenolate mofetil Usage: Mycophenolate mofetil is used for scientific research Mycophenolate mofetil Certificate: COA, HPLC, NMR, MSDS available CAS No.: 128794-94-5 Type: Antibiotic and Antimicrobial Agents,Antineoplastic Agents,Auxiliaries and Other Medicinal Chemicals,Immune Function Agents,Respiratory System Agents,Vitamins, Amino Acids and Coenzymes EINECS No.: N/A MF: C23H31NO7 Delivery Detail: Shipped in 2 days after payment Packaging Detail: Inner PP bag + Outer Al foil bag/tin/drum We can change some conditions according to client’s request. Factory directly sales Mycophenolic Acid Powder/ mycophenolate mofetil  Chemical information Mycophenolate mofetil CAS No.: 128794-94-5 Synonyms: Mycophenolate mofetil 2-morpholin-4-ylethyl 6-(4-hydroxy-6-methoxy-7-methyl-3-oxo-1,3-dihydro-2-benzofuran-5-yl)-4-methylhex-4-enoate; MYCOPHENOLATE MOFITILE; MYCOPHENOLATE MOFETIL(CELLCEPT); MYCOPHENALATE MOFETIL; MYCOPHENOLATE MOFETIL EP IMPURITY A (= USD RC A); Mycophenolatemofetil; Mycophenolate mofetil; MYCOPHENOLATE; 6-((7-hydroxy-5-methoxy-4-methyl-1-oxo-3h-isobenzofuran-6-yl))-4-methyl-hex-4-enoic acid 2-morpholinoethyl ester; (E)-2-morpholinoethyl 6-(4-hydroxy-6-methoxy-7-methyl-3-oxo-1,3-dihydroisobenzofuran-5-yl)-4-methylhex-4-enoate; MYCOPHENOLATEMOFETIL; Mycophenolate mofetil (CellCept); Mycophenolate Mofetil; MYCOPHENOLATE MOFETIL FOR PEAK IDENTIFICATION, EP STANDARD; Formula: C23H31NO7 Exact Mass: 433.21000 Molecular Weight: 433.49500 Appearance & Physical State White to off-white crystalline powder Melting Point 95-96ºC Storage Condition 2-8ºC Purity & Quality    Mycophenolate mofetil  Purity(HPLC):  99.32%  Mycophenolate mofetil   Identity (NMR):     Consistent with structure     HPLC Spectrum Of  Mycophenolate mofetil      HPLC Spectrum Of  Mycophenolate mofetil      Biological Activity Mycophenolate Mofetil is a non-competitive, selective and reversible inhibitor of inosine monophosphate dehydrogenase I/II with IC50 of 39 nM and […]

  • Sep, Thu, 2020
Pharmaceutical

Runyu supply vitamin k2 mk4 powder vitamin k2 mk7 powder pure vitamin k2 mk4 powder

Quick Details Port: TIANJIN;SHANGHAI;QINGDAO;DALIAN Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram,Paypal Supply Ability: 10000 Kilogram/Kilograms per Month Other Names: VK2 package: powder 25kg/drum; oil: iron drum Grade Standard: Medicine Grade Product Name: Vitamin K2 Powder Purity: 98% Appearance: Light yellow to white powder CAS No.: 11032-49-8 Type: Vitamins, Amino Acids and Coenzymes application: medicine Grade EINECS No.: 201-564-2 MF: C31H46O2 Packaging Detail: 25kilograms per cardboard barrel; inside packing : double food plastic bags; outside packing : cardboard barrel 1kilograms per box; inside packing : double food plastic bags+foil; outside packing : box   Product Description Runyu supply vitamin k2 mk4 powder vitamin k2 mk7 powder pure vitamin k2 mk4 powder Introduction  Vitamin K2, the main storage form in animals, has several subtypes, which differ in isoprenoid chain length. These vitamin K2 homologues are called menaquinones, and are characterized by the number of isoprenoid residues in their side chains. Menaquinones are abbreviated MK-n, where M stands for menaquinone, the K stands for vitamin K, and the n represents the number of isoprenoid side chain residues. For example, menaquinone-4 (abbreviated MK-4) has four isoprene residues in its side chain. Menaquinone-4 (also known as menatetrenone from its four isoprene residues) is the most common type of […]

  • Sep, Thu, 2020
Pharmaceutical

Bulk HRK CAS 80214-83-1 Roxithromycin Powder

Quick Details Port: China port Payment Terms: L/C,T/T,Western Union,MoneyGram, Trade Assurance Supply Ability: 8000.0 Kilogram/Kilograms per Month Bulk HRK CAS 80214-83-1 Roxithromycin Powder Other Names: Roxithromycin Usage: Animal Pharmaceuticals Grade Standard: Feed Grade,food grade,Medicine Grade Sample: Roxithromycin Avaliable Product Name: Bulk HRK CAS 80214-83-1 Roxithromycin Powder Purity: 99%min Roxithromycin Active Ingredient: Roxithromycin Appearance: White Powder CAS No.: 80214-83-1 Assay: 99%min, 98.0% –101.0% Type: Antibiotic and Antimicrobial Agents Storage: Cool Dry Place CAS: 80214-83-1 EINECS No.: N/M MF: C41H76N2O15 Shelf Life: 2 years Application: Pharmaceutical Products Certificate: ISO 9001 GMP Packaging Detail: 1kg per Foil Bag, 10 Bags per carton. 25 kg per Drum. Or Customized Package Bulk HRK CAS 80214-83-1 Roxithromycin Powder

  • Sep, Thu, 2020
Pharmaceutical

High purity Pimobendan CAS 74150-27-9 professional engineers competitive price

Quick Details Port: Any port of China Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram,TT 100% in advance Supply Ability: 10.0 Kilogram/Kilograms per Month Other Names: Pimobendan Usage: Animal Pharmaceuticals Delivery time: Within 2days Grade Standard: food grade,Medicine Grade Product Name: Pimobendan Purity: 99% Shelf life: 2 Years Appearance: white powder Molecular weight: 334.37 CAS No.: 74150-27-9 Type: Vitamins, Amino Acids and Coenzymes,Pimobendan Payment: TT.Western Union .Credit Card Storage: Cool Dry Place Test Method: HPLC UV COA: Availalbe EINECS No.: 640-420-7 MF: C19H18N4O2 Certificate: ISO FDA COA MSDS Packaging Detail: 25kgs packaging Fiber drum outside and plastic bag inside 1-25kgs packaging aluminium bag outside and double plastic bag inside Delivery Detail: within 2 days when get the payment Shipping : We have Professional shipping agent, based on customers ‘ demand for transport By express :FEDEX,DHL,EMS ,UPS,TNT ect. By SEA and By AIR Product Description High purity Pimobendan CAS 74150-27-9 professional engineers competitive price  Introduction Product Name   Pimobendan  CAS  74150-27-9  Category  API Quality Standard EP/USP MSDS Available COA Contact with Senwayer for updated version COA. Sample Available MOQ 1g,1kg Delivery Date In 3 days Place Of Origin China Application Pharmaceutical raw materials   Function   Strong heart medicine.There are strong positive muscle strength and strong […]

  • Sep, Thu, 2020
Plant Extract

Reference standard 98% Soyasaponin BB HPLC CAS 51330-27-9

Quick Details Port: Shanghai,Tianjin,Beijing,Qingdao Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 800.0 Gram/Grams per Month Form: Powder Extraction Type: Solvent Extraction Product Name: 98% Soyasaponin BB Grade: Reference standard Specification: 98% Soyasaponin BB Appearance: Off-white Powder MOQ: 20mg Type: 98% Soyasaponin BB Test Method: HPLC MS CAS: 51330-27-9 Part: 98% Soyasaponin BB Packaging: BOTTLE Packaging Detail: Packaging: Small brown glass bottle, standard packaging 10mg, 20mg, 50mg; can be packed according to customer needs. Reference standard 98% Soyasaponin BB   Product SKU HS031666 Molecular formula C48H78O18 English Name Soyasaponin BB Molecular Weight 943.134 CAS 51330-27-9 Grade Reference standard HPLC 98% Product Model HPLC>98   Soyasaponin BbSoyasaponin Bb      CAS   51330-27-9          Molecular Weight:943.134        Formula:C48H78O18 Purity:                  HPLC98%   Appearance:     White powderTest Method:    HPLC; Mass;NMR   Usage:                 For laboratory research use only,not for human or diganostic use.   Package              20mg~1g per bottle.Storage:           Store in a well closed container, protected from air and light.Prepare and use solutions at the time of testing. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20℃. Generally, these will be useable for […]

  • Sep, Thu, 2020
Pharmaceutical

Custom peptide FOXO4 DRI/foxo4 dri/FOXO4-DRI Peptide Chengdu Youngshe

Quick Details Port: Chengdu Payment Terms: T/T,MoneyGram Supply Ability: 500.0 Gram/Grams per Month Other Names: FOXO4-DRI Usage: Animal Pharmaceuticals Type: Vitamins, Amino Acids and Coenzymes Grade Standard: Tech Grade Purity: 95% MF: N/A CAS No.: N/A Packaging Detail: plastic/glass bottle protected by bubble film Product Description FOX 04DRI / Senolytics   FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.     FOXO4 DRI peptide comprising the amino acid sequence:LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice. New Information P1 Chengdu YoungShe Chemical Co Ltd is dedicating to be the most professional, efficient,and reliable partner for global customers on cosmetic peptides. You can select more than 200 kinds of cosmetic peptides here.And we are keeping developing new products and continuously marketing them for sale.   YoungShe Chem provide a one-stop service on cosmetic peptides.It will save you lots of time,energy and money.You will have very pleasant experience with us.Youngshe Chem,your personal cosmetic peptide consult.   Since […]

  • Sep, Thu, 2020
Pharmaceutical

Monobenzone Powder For Monobenzone Cream/4-Benzyloxyphenol

Quick Details Port: Tianjin/Shanghai/Ningbo/Dalian Payment Terms: L/C,T/T,Western Union,Paypal Supply Ability: 1000 Kilogram/Kilograms per Week Grade Standard: cosmetic grade Purity: 99% MW: 308.37 main function: Skin Whitening sample: 10g free for test MOQ: 1KG CAS No.: 103-16-2 Type: Skin Whitening appearance: White crystal powder shelf life: 24 months EINECS No.: 203-083-3 MF: C20H20O3 mesh: 100% pass 80 mesh Delivery Detail: within 3 working days after payment,according to quantity Packaging Detail: 1kg with double plastic container inside/Aluminum foil bag outside 25 kg with double plastic container inside/fiber drum outside N.W: 25kgs. I.D. 35 x H51 cm Monobenzone Powder For Monobenzone Cream/4-Benzyloxyphenol   Welcome to Realin Basic Information Product Name: Monobenzone  Appearance : Off-Wthite Powder  CAS: 103-16-2  Molecular formula: C20H20O3  Molecular weight : 308.371  Supplier name:           Xi'an Realin Synonyms: (Benzyloxy)phenol; p-Hydroxyphenyl benzyl ether; 4-(Phenylmethoxy)phenol; Agerite alba; Benoquin; Benzoquin; Benzyl hydroquinone; Depigman; Hydroquinone benzyl ether; Monobenzone; Monobenzyl hydroquinone; PBP; Pigmex; 4-benzyloxy phenol (Monobenzone); 4-benzyloxy phenol; 4-(benzyloxy)phenol; 4-Benzyloxyphenol; PHENOL,4-(PHENYLMETHOXY)-  Specification 99.5% Main Function 1.Monobenzone is the monobenzyl ether of hydroquinone. Monobenzone occurs as a white, almost tasteless crystalline powder, soluble in alcohol and practically insoluble in water.  2.Monobenzone is a compound used as a topical drug for medical depigmentation. The topical application of monobenzone in animals decreases the excretion of melanin from melanocytes.The same action is thought to be responsible for the depigmenting effect of the drug in humans. Monobenzone may cause destruction of melanocytes thus, bringing about permanent dipigmentation in vitiligo patients. 3.Monobenzone is the monobenzyl ether of hydroquinone. Monobenzone powder can be compounded to make a depigmenting cream.  It is used to whiten patchy skin and create and even skin tone that is pale and smooth. 4.Monobenzone USP, is a strong depigmentation agent, used to treat the patients suffering from vitiligo. **********************************************************************************************  Entity Shooting/Picture Show   Why Realin 1.100% Pure Nature Raw Material, Selecting excellent planting base 2.Our factory self-produced, the quality can be strictly controlled 3.Quick delivery, firm package,stocks supply 4.Professional sales team, Providing any feedback from the customers 5.Regarding customer benefit as the starting point, pay attention to the real needs of the customer Delivery/Payment Terms and Package 1.Delivery:   By UPS/DHL/TNT/EMS or by Air/ Sea as per Qty.2.Samples:   Within 48 Hours.                                                Payment: Paypal,Western Union and T/T Method: Using Western Union and Paypal when the amount is less than US$5000.   Package  1) 25kg/drum (25kg net weight, 28kg gross weight; Packed in a cardboard-drum with two  […]

  • Sep, Thu, 2020
Plant Extract

100% Natural and Organic Bamboo Leaf Extract powder bamboo leaf Flavonoid

Quick Details Form: Powder Sample: 10-20g Solubility: Good water-solubility Product Name: bamboo leaf extract Extraction Type: Solvent Extraction Active Ingredient: bamboo leaf Flavonoid Latin Name: Caulis Bambusae in Taenia Shelf life: 2 Years Specification: 40% Grade: Food grade Appearance: Brown Yellow Powder MOQ: 1KG Type: Herbal Extract Test Method: HPLC Part: Leaf Packaging: BOTTLE,DRUM,Plastic Container Variety: herbal extract Packaging Detail: Sealed export grade drums & double of sealed plastic bag. Small package as costumer’s requirement Selling Units: Single item Single package size: 20X15X10 cm Single gross weight: 1.5 KG

  • Sep, Thu, 2020
Pharmaceutical

Magnesium gluconate cas 3632-91-5

Quick Details Port: Shanghai Payment Terms: L/C,D/A,D/P,T/T,Western Union,MoneyGram Supply Ability: 1000 Tonne/Tonnes per Year Other Names: Magnesium Gluconate Usage: Animal Pharmaceuticals Type: Vitamins, Amino Acids and Coenzymes EINECS No.: 222-848-2 Grade Standard: cosmetic grade,Feed Grade,food grade,Medicine Grade Purity: 99% MF: C12H22MgO14,C12H22MgO14 Appearance: White Crystalline Powder CAS No.: 3632 -91-5 Packaging Detail: 25kg/drum, two plastic bags inside Magnesium gluconate cas 3632-91-5 Specifications CAS No.:3632-91-5 Other Names:magnesium D-gluconate hydrate MF:C12H22MgO14 EINECS No.:222-848-2 Place of Origin: Anhui, China (Mainland) Type:Nutrition Enhancers, Stabilizers Brand Name:Joye Model Number:food grade   Specification: Magnesium Gluconate  CAS No: 3632-91-5  EINECS No: 222-848-2  Molecular formula: C12H22MgO14  Molecuar weight: 414.5997 Magnesium Gluconate Chemical name:Magnesium Gluconate Molecular formula:C12H22MgeO14.2H2O dihydrate  Molecular weight:450.63 dihydrate  CAS NO.:59625-89-7 dihydrate  Standard :USP/FCC Characters:white fine powder or granule and soluble in water.  Performance and use: mainly used as nutriment and diet additive (1) play an important role for maintaining nerve impulse drive and nerve muscle sensitivity..  (2) good magnesian food hardening agent. Packing:Paperboard drum, full paper drum and brown paper bag lined with PE plastic bag. Net weight is 25KG Storage:Store in dry, ventilated and clean environments in room temperature. Transportation:non-hazardous product and transport by general chemical products.   Item Index USP   Content 98.0%-102.0% Magnesium content:5.06%-5.86%(calculated from […]